PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 377aa    MW: 42946.8 Da    PI: 5.3974
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629473.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t ++  g+ R++k+c++rw +yl
   XP_009629473.1 14 KGPWTPEEDQKLIDYIQKYGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.45.8e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
   XP_009629473.1  67 RGRFSFEEEETIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.597965IPR017930Myb domain
SuperFamilySSF466892.62E-3211108IPR009057Homeodomain-like
SMARTSM007174.6E-141363IPR001005SANT/Myb domain
PfamPF002498.7E-171461IPR001005SANT/Myb domain
CDDcd001674.38E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.34266116IPR017930Myb domain
SMARTSM007174.8E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1567111IPR001005SANT/Myb domain
CDDcd001676.10E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDQKLIDYIQ KYGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILN PSLYNSSHQM NLSRLFGHVQ PLVNPEVLRL ATSLLSSQRQ  180
NSNFLMPNNL QENQICNPQV QNQLPQMVQI TSQVQTPIQD IPTCTTLCTT SCVPFSSEAQ  240
LMQPPPNMEQ FSSNLENISL QNCQVNEWQS NGVPSNLTDD YFAVQNYGYY HELDDSIRDP  300
PPSDASTFQS NDSNNFSFQS VLSTLSTPSS SPTTLNSNST YYNNSSSTTT EDERDSYCSN  360
MLNFDIPNIW DSTNEFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629473.10.0PREDICTED: protein ODORANT1-like
TrEMBLM1C1H60.0M1C1H6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000576900.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-114MYB-like 102